PDB entry 1f58

View 1f58 on RCSB PDB site
Description: igg1 fab fragment (58.2) complex with 24-residue peptide (residues 308-333 of hiv-1 gp120 (mn isolate) with ala to aib substitution at position 323
Class: Viral protein/Immune system
Keywords: IMMUNOGLOBULIN, FAB, HIV-1, GP120, V3, Viral protein-Immune system COMPLEX
Deposited on 1998-10-21, released 1999-02-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (igg1 antibody 58.2 (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F58 (0-227)
    Domains in SCOPe 2.08: d1f58h1, d1f58h2
  • Chain 'L':
    Compound: protein (igg1 antibody 58.2 (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F58 (0-215)
    Domains in SCOPe 2.08: d1f58l1, d1f58l2
  • Chain 'P':
    Compound: envelope glycoprotein gp120
    Species: Human immunodeficiency virus type 1 group M subtype B, synthetic [TaxId:11696]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f58H (H:)
dvqlqqsgpdlvkpsqslsltctvtgysitsgyswhwirqfpgnklewmgyihysagtny
npslksrisitrdtsknqfflqlnsvttedtatyycareeampygnqayyyamdcwgqgt
tvtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
avlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f58L (L:)
divltqspaslavslgqratisckasqgvdfdgasfmnwyqqkpgqppkllifaastles
giparfsgrgsgtdftlnihpveeedaatyycqqshedpltfgagtklelkradaaptvs
ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
stltltkdeyerhnsytceathktstspivksfnra

  • Chain 'P':
    No sequence available.