PDB entry 1f53

View 1f53 on RCSB PDB site
Description: nmr structure of killer toxin-like protein sklp
Deposited on 2000-06-12, released 2000-12-27
The last revision prior to the SCOP 1.59 freeze date was dated 2000-12-27, with a file datestamp of 2000-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1f53a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f53A (A:)
  idhvpcrggenflkiwshsggqqsvdcyanrgridfggwwvdkistgnndliyydangds
  vrvdrwhditypnrppkvnsieil