PDB entry 1f53

View 1f53 on RCSB PDB site
Description: nmr structure of killer toxin-like protein sklp
Class: toxin
Keywords: killer toxin-like protein,SKLP, crystallin family
Deposited on 2000-06-12, released 2000-12-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast killer toxin-like protein
    Species: Streptomyces sp. [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F53 (0-83)
    Domains in SCOPe 2.08: d1f53a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f53A (A:)
idhvpcrggenflkiwshsggqqsvdcyanrgridfggwwvdkistgnndliyydangds
vrvdrwhditypnrppkvnsieil