PDB entry 1f52

View 1f52 on RCSB PDB site
Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with ADP
Class: ligase
Keywords: glutamine synthetase, ADP, MPD, LIGASE
Deposited on 2000-06-12, released 2000-06-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.243
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52a1, d1f52a2
  • Chain 'B':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52b1, d1f52b2
  • Chain 'C':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52c1, d1f52c2
  • Chain 'D':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52d1, d1f52d2
  • Chain 'E':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52e1, d1f52e2
  • Chain 'F':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52f1, d1f52f2
  • Chain 'G':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52g1, d1f52g2
  • Chain 'H':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52h1, d1f52h2
  • Chain 'I':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52i1, d1f52i2
  • Chain 'J':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52j1, d1f52j2
  • Chain 'K':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52k1, d1f52k2
  • Chain 'L':
    Compound: glutamine synthetase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f52l1, d1f52l2
  • Heterogens: MN, ADP, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52A (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52B (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52C (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52D (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52E (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52F (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52G (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52H (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52I (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52J (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52K (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52L (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv