PDB entry 1f52

View 1f52 on RCSB PDB site
Description: crystal structure of glutamine synthetase from salmonella typhimurium co-crystallized with adp
Deposited on 2000-06-12, released 2000-06-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-04, with a file datestamp of 2001-04-04.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.243
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52A (A:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52B (B:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52C (C:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52D (D:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52E (E:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52F (F:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52G (G:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52H (H:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52I (I:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52J (J:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52K (K:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f52L (L:)
    saehvltmlnehevkfvdlrftdtkgkeqhvtipahqvnaeffeegkmfdgssiggwkgi
    nesdmvlmpdastavidpffadstliircdilepgtlqgydrdprsiakraedylratgi
    adtvlfgpepefflfddirfgasisgshvaiddiegawnsstkyeggnkghrpgvkggyf
    pvppvdsaqdirsemclvmeqmglvveahhhevatagqnevatrfntmtkkadeiqiyky
    vvhnvahrfgktatfmpkpmfgdngsgmhchmslakngtnlfsgdkyaglseqalyyigg
    vikhakainalanpttnsykrlvpgyeapvmlaysarnrsasiripvvaspkarrievrf
    pdpaanpylcfaallmagldgiknkihpgepmdknlydlppeeakeipqvagsleealna
    ldldreflkaggvftdeaidayialrreeddrvrmtphpvefelyysv