PDB entry 1f51

View 1f51 on RCSB PDB site
Description: a transient interaction between two phosphorelay proteins trapped in a crystal lattice reveals the mechanism of molecular recognition and phosphotransfer in singal transduction
Deposited on 2000-06-11, released 2000-08-23
The last revision prior to the SCOP 1.71 freeze date was dated 2000-08-23, with a file datestamp of 2000-08-23.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.228
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1f51a_
  • Chain 'B':
    Domains in SCOP 1.71: d1f51b_
  • Chain 'C':
    Domains in SCOP 1.71: d1f51c_
  • Chain 'D':
    Domains in SCOP 1.71: d1f51d_
  • Chain 'E':
    Domains in SCOP 1.71: d1f51e_
  • Chain 'F':
    Domains in SCOP 1.71: d1f51f_
  • Chain 'G':
    Domains in SCOP 1.71: d1f51g_
  • Chain 'H':
    Domains in SCOP 1.71: d1f51h_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f51A (A:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f51A (A:)
    isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
    ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
    hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
    d
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f51B (B:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f51C (C:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f51C (C:)
    isdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsnl
    ktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsresen
    hltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieigl
    d
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f51D (D:)
    nisdtaltnelihllghsrhdwmnklqlikgnlslqkydrvfemieemvidakhesklsn
    lktphlafdfltfnwkthymtleyevlgeikdlsaydqklaklmrklfhlfdqavsrese
    nhltvslqtdhpdrqlilyldfhgafadpsafddirqngyedvdimrfeitsheclieig
    ld
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f51E (E:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f51F (F:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f51G (G:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f51H (H:)
    nekilivddqsgirillnevfnkegyqtfqaanglqaldivtkerpdlvlldmkipgmdg
    ieilkrmkvidenirviimtaygeldmiqeskelgalthfakpfdideirdavkkylpl