PDB entry 1f4y

View 1f4y on RCSB PDB site
Description: crystal structure of an anti-carbohydrate antibody directed against vibrio cholerae o1 in complex with antigen
Class: immune system
Keywords: anti-carbohydrate antibody
Deposited on 2000-06-10, released 2000-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody s-20-4, fab fragment, heavy chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1f4yh1, d1f4yh2
  • Chain 'L':
    Compound: antibody s-20-4, fab fragment, light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d1f4yl1, d1f4yl2
  • Heterogens: MGU

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4yH (H:)
    evqleesggglvtpggslrlscaasgyvfstydmswvrqtpekrlewvafissgggrtsy
    pdtvkgrftisrddakntlylqmsslqsedtamyyctrhfyavldywgrgttltvssakt
    tppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
    lsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4yL (L:)
    qavvtqesalttspgetvtltcrsstgtvttsnyanwvqekpdhlftgligatnnraagv
    pvrfsgsliggkaaltitgaqtedeaiyfcalwysghwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtveksls