PDB entry 1f4u

View 1f4u on RCSB PDB site
Description: thermophilic p450: cyp119 from sulfolobus solfactaricus
Deposited on 2000-06-09, released 2000-10-23
The last revision prior to the SCOP 1.59 freeze date was dated 2000-10-23, with a file datestamp of 2000-10-23.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.219
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1f4ua_
  • Chain 'B':
    Domains in SCOP 1.59: d1f4ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4uA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlks
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4uB (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlks