PDB entry 1f4u

View 1f4u on RCSB PDB site
Description: thermophilic p450: cyp119 from sulfolobus solfactaricus
Class: oxidoreductase
Keywords: P450 fold, OXIDOREDUCTASE
Deposited on 2000-06-09, released 2000-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450 119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f4ua_
  • Chain 'B':
    Compound: cytochrome p450 119
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f4ub_
  • Heterogens: SO4, HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f4uA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f4uA (A:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f4uB (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlksne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f4uB (B:)
    mydwfsemrkkdpvyydgniwqvfsyrytkevlnnfskfssdltgyherledlrngkirf
    diptrytmltsdpplhdelrsmsadifspqklqtletfirettrslldsidpreddivkk
    lavplpiiviskilglpiedkekfkewsdlvafrlgkpgeifelgkkyleligyvkdhln
    sgtevvsrvvnsnlsdieklgyiillliagnetttnlisnsvidftrfnlwqrireenly
    lkaieealrysppvmrtvrktkervklgdqtieegeyvrvwiasanrdeevfhdgekfip
    drnpnphlsfgsgihlclgaplarleariaieefskrfrhieildtekvpnevlngykrl
    vvrlks