PDB entry 1f4s

View 1f4s on RCSB PDB site
Description: structure of transcriptional factor alcr in complex with a target dna
Deposited on 2000-06-09, released 2001-09-28
The last revision prior to the SCOP 1.65 freeze date was dated 2001-09-28, with a file datestamp of 2001-09-28.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Domains in SCOP 1.65: d1f4sp_

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4sP (P:)
    gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
    sknss