PDB entry 1f4s

View 1f4s on RCSB PDB site
Description: structure of transcriptional factor alcr in complex with a target DNA
Class: transcription/DNA
Keywords: protein-DNA complex, zinc binuclear cluster protein, transcription/DNA complex
Deposited on 2000-06-09, released 2001-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(p*cp*gp*tp*gp*cp*gp*gp*ap*tp*c)-3')
  • Chain 'B':
    Compound: DNA (5'-d(p*gp*ap*tp*cp*cp*gp*cp*ap*cp*g)-3')
  • Chain 'P':
    Compound: ethanol regulon transcriptional factor
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21228 (4-63)
      • insertion (0-1)
      • insertion (62-64)
    Domains in SCOPe 2.08: d1f4sp_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4sP (P:)
    gsmadtrrrqnhscdpcrkgkrrcdapenrneanengwvscsnckrwnkdctfnwlssqr
    sknss