PDB entry 1f4r

View 1f4r on RCSB PDB site
Description: crystal structure of the human aag DNA repair glycosylase complexed with 1,n6-ethenoadenine-DNA
Class: hydrolase/DNA
Keywords: protein-DNA complex, hydrolase/DNA complex
Deposited on 2000-06-08, released 2000-12-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-methyl-adenine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f4ra_
  • Chain 'D':
    Compound: DNA (5'-d(*gp*ap*cp*ap*tp*gp*(eda)p*tp*tp*gp*cp*cp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*gp*cp*ap*ap*tp*cp*ap*tp*gp*tp*cp*a)-3')
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f4rA (A:)
    kghltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrg
    grqtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrst
    lrkgtasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaa
    arvgvghagewarkplrfyvrgspwvsvvdrvaeqdtqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f4rA (A:)
    hltrlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggr
    qtprnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstvl
    kdrelcsgpsklcqalainksfdqrdlaqdeavwlergpavvaaarvgvghagewarkpl
    rfyvrgspwvsvvdrvaeq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.