PDB entry 1f4p

View 1f4p on RCSB PDB site
Description: y98w flavodoxin mutant 1.5a (d. vulgaris)
Class: electron transport
Keywords: electron transport, flavoprotein, FMN, 3D-strcture, Anisotropic Refinement, Redox protein
Deposited on 2000-06-08, released 2001-04-04
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.126
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris [TaxId:881]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • engineered (96)
    Domains in SCOPe 2.01: d1f4pa_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4pA (A:)
    pkalivygsttgnteytaetiareladagyevdsrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssweyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai