PDB entry 1f4j

View 1f4j on RCSB PDB site
Description: structure of tetragonal crystals of human erythrocyte catalase
Deposited on 2000-06-07, released 2000-06-21
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f4ja_
  • Chain 'B':
    Domains in SCOP 1.55: d1f4jb_
  • Chain 'C':
    Domains in SCOP 1.55: d1f4jc_
  • Chain 'D':
    Domains in SCOP 1.55: d1f4jd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4jA (A:)
    advlttgagnpvgdklnvitvgprgpllvqdvvftdemahfdreripervvhakgagafg
    yfevthditkyskakvfehigkktpiavrfstvagesgsadtvrdprgfavkfytedgnw
    dlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwdfwslrpeslhqvsflfsdr
    gipdghrhmngygshtfklvnangeavyckfhyktdqgiknlsvedaarlsqedpdygir
    dlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwphkdyplipvgklvlnrnpv
    nyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrhrlgpnylhipvncpyrarv
    anyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiqysgevrrfntanddnvtqv
    rafyvnvlneeqrkrlceniaghlkdaqifiqkkavknftevhpdygshiqalldkyna
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4jB (B:)
    dvlttgagnpvgdklnvitvgprgpllvqdvvftdemahfdreripervvhakgagafgy
    fevthditkyskakvfehigkktpiavrfstvagesgsadtvrdprgfavkfytedgnwd
    lvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwdfwslrpeslhqvsflfsdrg
    ipdghrhmngygshtfklvnangeavyckfhyktdqgiknlsvedaarlsqedpdygird
    lfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwphkdyplipvgklvlnrnpvn
    yfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrhrlgpnylhipvncpyrarva
    nyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiqysgevrrfntanddnvtqvr
    afyvnvlneeqrkrlceniaghlkdaqifiqkkavknftevhpdygshiqalldkynae
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4jC (C:)
    advlttgagnpvgdklnvitvgprgpllvqdvvftdemahfdreripervvhakgagafg
    yfevthditkyskakvfehigkktpiavrfstvagesgsadtvrdprgfavkfytedgnw
    dlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwdfwslrpeslhqvsflfsdr
    gipdghrhmngygshtfklvnangeavyckfhyktdqgiknlsvedaarlsqedpdygir
    dlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwphkdyplipvgklvlnrnpv
    nyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrhrlgpnylhipvncpyrarv
    anyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiqysgevrrfntanddnvtqv
    rafyvnvlneeqrkrlceniaghlkdaqifiqkkavknftevhpdygshiqalldkynae
    k
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4jD (D:)
    advlttgagnpvgdklnvitvgprgpllvqdvvftdemahfdreripervvhakgagafg
    yfevthditkyskakvfehigkktpiavrfstvagesgsadtvrdprgfavkfytedgnw
    dlvgnntpiffirdpilfpsfihsqkrnpqthlkdpdmvwdfwslrpeslhqvsflfsdr
    gipdghrhmngygshtfklvnangeavyckfhyktdqgiknlsvedaarlsqedpdygir
    dlfnaiatgkypswtfyiqvmtfnqaetfpfnpfdltkvwphkdyplipvgklvlnrnpv
    nyfaeveqiafdpsnmppgieaspdkmlqgrlfaypdthrhrlgpnylhipvncpyrarv
    anyqrdgpmcmqdnqggapnyypnsfgapeqqpsalehsiqysgevrrfntanddnvtqv
    rafyvnvlneeqrkrlceniaghlkdaqifiqkkavknftevhpdygshiqalldkyna