PDB entry 1f4i

View 1f4i on RCSB PDB site
Description: solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Class: DNA binding protein,transcription
Keywords: alpha helical bundle
Deposited on 2000-06-07, released 2000-12-20
The last revision prior to the SCOP 1.75 freeze date was dated 2000-12-20, with a file datestamp of 2007-06-04.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: uv excision repair protein protein rad23 homolog a
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54725 (0-44)
    • engineered (14)
  Domains in SCOP 1.75: d1f4ia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f4iA (A:)
  qekeaierlkalgfeeslviqayfaceknenlaanfllsqnfdde