PDB entry 1f4i

View 1f4i on RCSB PDB site
Description: solution structure of the hhr23a uba(2) mutant p333e, deficient in binding the hiv-1 accessory protein vpr
Deposited on 2000-06-07, released 2000-12-20
The last revision prior to the SCOP 1.69 freeze date was dated 2000-12-20, with a file datestamp of 2000-12-20.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1f4ia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f4iA (A:)
    qekeaierlkalgfeeslviqayfaceknenlaanfllsqnfdde