PDB entry 1f48

View 1f48 on RCSB PDB site
Description: crystal structure of the escherichia coli arsenite-translocating ATPase
Class: hydrolase
Keywords: p-loop, antimonite binding site, ATP binding site, HYDROLASE
Deposited on 2000-06-07, released 2000-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arsenite-translocating ATPase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08690 (0-582)
      • see remark 999 (59)
      • expression tag (583-585)
    Domains in SCOPe 2.07: d1f48a1, d1f48a2, d1f48a3
  • Heterogens: SB, MG, CD, CL, SBO, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f48A (A:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
    kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
    teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqpvasp
    ssdeylqqrpdipslsalvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhl
    ttsdpaahlsmtlngslnnlqvsridpheeteryrqhvletkgkeldeagkrlleedlrs
    pcteeiavfqafsrvireagkrfvvmdtaptghtlllldatgayhreiakkmgekghftt
    pmmllqdpertkvllvtlpettpvleaanlqadleragihpwgwiinnslsiadtrspll
    rmraqqelpqiesvkrqhasrvalvpvlaseptgidklkqlaghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f48A (A:)
    mqflqnippylfftgkggvgktsiscatairlaeqgkrvllvstdpasnvgqvfsqtign
    tiqaiasvpglsaleidpqaaaqqyrarivdpikgvlpddvvssineqlsgactteiaaf
    deftglltdaslltrfdhiifdtaptghtirllqlpgawssfidsnpegasclgpmagle
    kqreqyayavealsdpkrtrlvlvarlqkstlqevarthlelaaiglknqylvingvlpk
    teaandtlaaaiwereqealanlpadlaglptdtlflqpvnmvgvsalsrllstqprpdi
    pslsalvddiarnehglimlmgkggvgkttmaaaiavrladmgfdvhlttsdpaahlnnl
    qvsridpheeteryrqhvletkgkeldeagkrlleedlrspcteeiavfqafsrvireag
    krfvvmdtaptghtlllldattpmmllqdpertkvllvtlpettpvleaanlqadlerag
    ihpwgwiinnslsiadtrspllrmraqqelpqiesvkrqhasrvalvpvlaseptgidkl
    kqlaghhh