PDB entry 1f47

View 1f47 on RCSB PDB site
Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography
Class: cell cycle
Keywords: cell division zipa, CELL DIVISiON ftsz, SEPARATION, INNER MEMBRANE, TRANSMEMBRANE, CELL CYCLE
Deposited on 2000-06-07, released 2001-06-13
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein ftsz
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1f47b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f47B (B:)
    mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
    lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
    rrmmtpqklreyqdiirevkdana