PDB entry 1f47

View 1f47 on RCSB PDB site
Description: the bacterial cell-division protein zipa and its interaction with an ftsz fragment revealed by x-ray crystallography
Deposited on 2000-06-07, released 2001-06-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-21, with a file datestamp of 2004-09-21.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Domains in SCOP 1.69: d1f47b_

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f47B (B:)
  mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
  lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
  rrmmtpqklreyqdiirevkdana