PDB entry 1f45

View 1f45 on RCSB PDB site
Description: human interleukin-12
Deposited on 2000-06-07, released 2001-06-20
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-20, with a file datestamp of 2001-06-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f45A (A:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytchkggevlshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftc
    wwlttistdltfsvkssrgssdpqgvtcgaatlsaervrgdnkeyeysvecqedsacpaa
    eeslpievmvdavhklkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtw
    stphsyfsltfcvqvqgkskrekkdrvftdktsatvicrknasisvraqdryyssswsew
    asvpcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f45A (A:)
    iwelkkdvyvveldwypdapgemvvltcdtpeedgitwtldqssevlgsgktltiqvkef
    gdagqytcshsllllhkkedgiwstdilkdqkepknktflrceaknysgrftcwwlttis
    tdltfsvkssrgssdpqgvtcgaatlsaeeyeysvecqedsacpaaeeslpievmvdavh
    klkyenytssffirdiikpdppknlqlkplknsrqvevsweypdtwstphsyfsltfcvq
    vqkdrvftdktsatvicrsisvraqdryyssswsewasvpcs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f45B (B:)
    qnllravsnmlqkarqtlefypctseeidheditkdktstveaclpleltknesclnsre
    tsfitngsclasrktsfmmalclssiyedlkmyqvefktmnakllmdpkrqifldqnmla
    videlmqalnfnsetvpqkssleepdfyktkiklcillhafriravtidrvmsylnas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f45B (B:)
    qnllravsnmlqkarqtlefypcstveaclpleltknesctsfitngssfmmalclssiy
    edlkmyqvefktmnakllmdpkrqifldqnmlavidelmqalyktkiklcillhafrira
    vtidrvmsylnas