PDB entry 1f43

View 1f43 on RCSB PDB site
Description: solution structure of the mata1 homeodomain
Class: transcription
Keywords: Homeodomain, helix-turn-helix, TRANSCRIPTION
Deposited on 2000-06-07, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mating-type protein a-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f43a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f43A (A:)
    kkekspkgkssispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrmrs
    k