PDB entry 1f3y

View 1f3y on RCSB PDB site
Description: solution structure of the nudix enzyme diadenosine tetraphosphate hydrolase from lupinus angustifolius l.
Class: hydrolase
Keywords: Enzyme,MIXED 4-STRANDED BETA SHEET, 2-STRANDED ANTIPARALLEL SHEET, ALPHA-BETA-ALPHA SANDWICH
Deposited on 2000-06-06, released 2001-06-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-07, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diadenosine 5',5'''-p1,p4-tetraphosphate hydrolase
    Species: Lupinus angustifolius
    Database cross-references and differences (RAF-indexed):
    • Uniprot O04841 (0-164)
      • engineered (0-3)
    Domains in SCOP 1.75: d1f3ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3yA (A:)
    gplgsmdsppegyrrnvgiclmnndkkifaasrldipdawqmpqggidegedprnaaire
    lreetgvtsaeviaevpywltydfppkvreklniqwgsdwkgqaqkwflfkftgqdqein
    llgdgsekpefgewswvtpeqlidltvefkkpvykevlsvfaphl