PDB entry 1f3x

View 1f3x on RCSB PDB site
Description: s402p mutant of rabbit muscle pyruvate kinase
Class: transferase
Keywords: pyruvate kinase, S402P, muscle isozyme, TRANSFERASE
Deposited on 2000-06-06, released 2001-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.241
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xa1, d1f3xa2, d1f3xa3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xb1, d1f3xb2, d1f3xb3
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xc1, d1f3xc2, d1f3xc3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xd1, d1f3xd2, d1f3xd3
  • Chain 'E':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xe1, d1f3xe2, d1f3xe3
  • Chain 'F':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xf1, d1f3xf2, d1f3xf3
  • Chain 'G':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xg1, d1f3xg2, d1f3xg3
  • Chain 'H':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11974 (Start-529)
      • engineered (401)
    Domains in SCOPe 2.05: d1f3xh1, d1f3xh2, d1f3xh3
  • Heterogens: K, MN, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f3xA (A:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xA (A:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f3xB (B:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xB (B:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f3xC (C:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xC (C:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f3xD (D:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xD (D:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f3xE (E:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xE (E:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f3xF (F:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xF (F:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1f3xG (G:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xG (G:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1f3xH (H:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3xH (H:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasphstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp