PDB entry 1f3w

View 1f3w on RCSB PDB site
Description: recombinant rabbit muscle pyruvate kinase
Class: transferase
Keywords: pyruvate kinase, recombinant, muscle isozyme, TRANSFERASE
Deposited on 2000-06-06, released 2001-10-03
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.238
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wa1, d1f3wa2, d1f3wa3
  • Chain 'B':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wb1, d1f3wb2, d1f3wb3
  • Chain 'C':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wc1, d1f3wc2, d1f3wc3
  • Chain 'D':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wd1, d1f3wd2, d1f3wd3
  • Chain 'E':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3we1, d1f3we2, d1f3we3
  • Chain 'F':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wf1, d1f3wf2, d1f3wf3
  • Chain 'G':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wg1, d1f3wg2, d1f3wg3
  • Chain 'H':
    Compound: pyruvate kinase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1f3wh1, d1f3wh2, d1f3wh3
  • Heterogens: K, MN, PYR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f3wA (A:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wA (A:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f3wB (B:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wB (B:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f3wC (C:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wC (C:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f3wD (D:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wD (D:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1f3wE (E:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wE (E:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1f3wF (F:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wF (F:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1f3wG (G:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wG (G:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1f3wH (H:)
    skshseagsafiqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetl
    kemiksgmnvarmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirt
    glikgsgtaevelkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddgli
    slqvkqkgpdflvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvf
    asfirkaadvhevrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgiei
    paekvflaqkmiigrcnragkpvicatqmlesmikkprptraegsdvanavldgadciml
    sgetakgdypleavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasy
    kclaaalivltesgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqea
    waedvdlrvnlamnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3wH (H:)
    iqtqqlhaamadtflehmcrldidsapitarntgiictigpasrsvetlkemiksgmnva
    rmnfshgtheyhaetiknvrtatesfasdpilyrpvavaldtkgpeirtglikgsgtaev
    elkkgatlkitldnaymekcdenilwldyknickvvdvgskvyvddglislqvkqkgpdf
    lvtevenggflgskkgvnlpgaavdlpavsekdiqdlkfgveqdvdmvfasfirkaadvh
    evrkilgekgknikiiskienhegvrrfdeileasdgimvargdlgieipaekvflaqkm
    iigrcnragkpvicatqmlesmikkprptraegsdvanavldgadcimlsgetakgdypl
    eavrmqhliareaeaamfhrklfeelarasshstdlmeamamgsveasykclaaalivlt
    esgrsahqvaryrprapiiavtrnhqtarqahlyrgifpvvckdpvqeawaedvdlrvnl
    amnvgkargffkkgdvvivltgwrpgsgftntmrvvpvp