PDB entry 1f3p

View 1f3p on RCSB PDB site
Description: ferredoxin reductase (bpha4)-nadh complex
Class: oxidoreductase
Keywords: Rossmann fold, OXIDOREDUCTASE
Deposited on 2000-06-06, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin reductase
    Species: Pseudomonas sp. [TaxId:307]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f3pa1, d1f3pa2, d1f3pa3, d1f3pa4
  • Heterogens: FAD, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f3pA (A:)
    msqealkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgd
    aekirldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlq
    gatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprl
    msraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlan
    dalaraaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgia
    varhlvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkg
    rivgatcvnnardfaplrrllavgakpdraaladpatdlrklaaavaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3pA (A:)
    alkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaeki
    rldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapralptlqgatm
    pvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslvetqprlmsra
    apatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgigvlandala
    raaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarh
    lvdptapgyaelpwywsdqgalriqvaglasgdeeivrgevsldapkftlielqkgrivg
    atcvnnardfaplrrllavgakpdraaladpatdlrklaaa