PDB entry 1f3l

View 1f3l on RCSB PDB site
Description: crystal structure of the conserved core of protein arginine methyltransferase prmt3
Deposited on 2000-06-05, released 2001-03-14
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.209
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f3la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3lA (A:)
    dlqededgvyfssyghygiheemlkdkvrtesyrdfiyqnphifkdkvvldvgcgtgils
    mfaakagakkviavdqseilyqamdiirlnkledtivlikgkieevslpvekvdviisew
    mgyfllfesmldsvlyakskylakggsvypdictislvavsdvskhadriafwddvygfn
    mscmkkavipeavvevvdhktlisdpcdikhidchttsisdlefssdftlrttktamcta
    vagyfdiyfeknchnrvvfstgpqstkthwkqtifllekpfpvkagealkgkitvhknkk
    dprslivtltlnsstqtyslq