PDB entry 1f3j

View 1f3j on RCSB PDB site
Description: histocompatibility antigen I-ag7
Class: immune system
Keywords: histocompatibility antigen, MHC, peptide complex, immune system
Deposited on 2000-06-04, released 2000-09-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.221
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h-2 class II histocompatibility antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f3ja1, d1f3ja2
  • Chain 'B':
    Compound: MHC class II nod
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f3jb1, d1f3jb2
  • Chain 'D':
    Compound: h-2 class II histocompatibility antigen
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f3jd1, d1f3jd2
  • Chain 'E':
    Compound: MHC class II nod
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f3je1, d1f3je2
  • Chain 'P':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Lysozyme C
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jA (A:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jB (B:)
    erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
    qylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntlvcsvtdfyp
    akikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspi
    tvewraq
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jD (D:)
    ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
    lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3jE (E:)
    erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
    qylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntlvcsvtdfyp
    akikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspi
    tvewraq
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.