PDB entry 1f3j
View 1f3j on RCSB PDB site
Description: histocompatibility antigen I-ag7
Class: immune system
Keywords: histocompatibility antigen, MHC, peptide complex
Deposited on
2000-06-04, released
2000-09-20
The last revision prior to the SCOP 1.73 freeze date was dated
2003-04-01, with a file datestamp of
2007-07-06.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.221
AEROSPACI score: 0.1
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: h-2 class II histocompatibility antigen
Species: MUS MUSCULUS
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1f3ja1, d1f3ja2 - Chain 'B':
Compound: MHC class II nod
Species: MUS MUSCULUS
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1f3jb1, d1f3jb2 - Chain 'D':
Compound: h-2 class II histocompatibility antigen
Species: MUS MUSCULUS
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1f3jd1, d1f3jd2 - Chain 'E':
Compound: MHC class II nod
Species: MUS MUSCULUS
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.73: d1f3je1, d1f3je2 - Chain 'P':
Compound: Lysozyme C
Species: GALLUS GALLUS
Database cross-references and differences (RAF-indexed):
- Chain 'Q':
Compound: Lysozyme C
Species: GALLUS GALLUS
Database cross-references and differences (RAF-indexed):
- Heterogens: NAG, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1f3jA (A:)
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
pe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1f3jB (B:)
erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
qylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntlvcsvtdfyp
akikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspi
tvewraq
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1f3jD (D:)
ieadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqgg
lqniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvini
twlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhwe
pe
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1f3jE (E:)
erhfvhqfkgecyftngtqrirlvtryiynreeylrfdsdvgeyravtelgrhsaeyynk
qylertraeldtacrhnyeetevptslrrleqpnvaislsrtealnhhntlvcsvtdfyp
akikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgevytchvehpslkspi
tvewraq
- Chain 'P':
No sequence available.
- Chain 'Q':
No sequence available.