PDB entry 1f3g

View 1f3g on RCSB PDB site
Description: three-dimensional structure of the escherichia coli phosphocarrier protein iii glc
Deposited on 1991-08-28, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.162
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1f3g__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3g_ (-)
    tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
    iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
    visnmdeikeliklsgsvtvgetpvirikk