PDB entry 1f3f

View 1f3f on RCSB PDB site
Description: structure of the h122g nucleoside diphosphate kinase / d4t-triphosphate.mg complex
Class: transferase
Keywords: nucleoside diphosphate kinase, anti-hiv nucleoside analogue, phosphorylation, ch...o bond,, transferase
Deposited on 2000-06-02, released 2000-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nucleoside diphosphate kinase)
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1f3fa_
  • Chain 'B':
    Compound: protein (nucleoside diphosphate kinase)
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1f3fb_
  • Chain 'C':
    Compound: protein (nucleoside diphosphate kinase)
    Species: Dictyostelium discoideum [TaxId:44689]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22887 (Start-154)
      • engineered (121)
    Domains in SCOPe 2.07: d1f3fc_
  • Heterogens: PO4, MG, D4T, D4D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f3fA (A:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3fA (A:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f3fB (B:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3fB (B:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f3fC (C:)
    mstnkvnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehk
    erpffgglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrni
    iggsdsvesanreialwfkpeelltevkpnpnlye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3fC (C:)
    vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
    gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
    svesanreialwfkpeelltevkpnpnlye