PDB entry 1f3d

View 1f3d on RCSB PDB site
Description: catalytic antibody 4b2 in complex with its amidinium hapten.
Class: immune system
Keywords: catalytic antibody, amidinium, haptenic charge, IMMUNE SYSTEM
Deposited on 2000-06-02, released 2000-09-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-07-04, with a file datestamp of 2012-06-29.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.198
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: catalytic antibody 4b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F3D (0-216)
    Domains in SCOPe 2.06: d1f3dh1, d1f3dh2
  • Chain 'J':
    Compound: catalytic antibody 4b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F3D (0-End)
    Domains in SCOPe 2.06: d1f3dj1, d1f3dj2
  • Chain 'K':
    Compound: catalytic antibody 4b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F3D (0-End)
    Domains in SCOPe 2.06: d1f3dk1, d1f3dk2
  • Chain 'L':
    Compound: catalytic antibody 4b2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1F3D (0-End)
    Domains in SCOPe 2.06: d1f3dl1, d1f3dl2
  • Heterogens: SO4, TPM, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3dH (H:)
    eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
    nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1f3dJ (J:)
    dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3dJ (J:)
    dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrna
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1f3dK (K:)
    eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
    nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3dK (K:)
    eiqlqqsgpelvkpgasvkvsckasgysfidynihwvkqshgkslewigyivpysggttf
    nqkfkgkatltvdkssstafmhlnsltfedsavyycandydgvywgqgttltvssakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1f3dL (L:)
    dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnac
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3dL (L:)
    dvlmtqtplslpvslgdqvsiscrssqsifhsdgktylewhlqkpgqspklliykvskrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrna