PDB entry 1f3c

View 1f3c on RCSB PDB site
Description: refined solution structure of 8kda dynein light chain (dlc8)
Class: contractile protein
Keywords: dynein, light chain, DLC8, microtubules
Deposited on 2000-06-02, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dynein
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f3ca_
  • Chain 'B':
    Compound: dynein
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1f3cb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f3cA (A:)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f3cB (B:)
mcdrkaviknadmseemqqdsvecatqalekyniekdiaahikkefdkkynptwhcivgr
nfgsyvthetkhfiyfylgqvaillfksg