PDB entry 1f3b

View 1f3b on RCSB PDB site
Description: crystal structure of mgsta1-1 in complex with glutathione conjugate of benzo[a]pyrene epoxide
Class: transferase
Keywords: glutathione S-transferase, GST, BPDE, TRANSFERASE
Deposited on 2000-06-01, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase ya chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13745 (0-221)
      • modified residue (110)
    Domains in SCOPe 2.07: d1f3ba1, d1f3ba2
  • Chain 'B':
    Compound: glutathione s-transferase ya chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13745 (0-221)
      • modified residue (110)
    Domains in SCOPe 2.07: d1f3bb1, d1f3bb2
  • Heterogens: GBX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3bA (A:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafkiq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f3bB (B:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafkiq