PDB entry 1f3a

View 1f3a on RCSB PDB site
Description: crystal structure of mgsta1-1 in complex with gsh
Class: transferase
Keywords: Glutathione S-Transferase, Glutathione
Deposited on 2000-06-01, released 2000-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.191
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase ya chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f3aa1, d1f3aa2
  • Chain 'B':
    Compound: glutathione s-transferase ya chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1f3ab1, d1f3ab2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f3aA (A:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3aA (A:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f3aB (B:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafkiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f3aB (B:)
    agkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveid
    gmklaqtrailnyiatkydlygkdmkeralidmysegildltemigqlvlcppdqreakt
    alakdrtknrylpafekvlkshgqdylvgnrltrvdihllevllyveefdaslltpfpll
    kafksrisslpnvkkflqpgsqrkppmdakqiqearkafki