PDB entry 1f38

View 1f38 on RCSB PDB site
Description: x-ray crystallographic structure of precorrin 8w decarboxylase, the product of gene mt0146 in the methanobacterium thermoautotrophicum genome
Class: lyase
Keywords: Decarboxylase, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, LYASE
Deposited on 2000-05-31, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: precorrin-8w decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MT0146
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26249
      • modified residue (0)
      • modified residue (18)
      • modified residue (25)
      • modified residue (72)
      • modified residue (86)
      • modified residue (143)
      • modified residue (171-172)
    Domains in SCOPe 2.07: d1f38a_
  • Chain 'B':
    Compound: precorrin-8w decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MT0146
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26249
      • modified residue (0)
      • modified residue (18)
      • modified residue (25)
      • modified residue (72)
      • modified residue (86)
      • modified residue (143)
      • modified residue (171-172)
    Domains in SCOPe 2.07: d1f38b_
  • Chain 'C':
    Compound: precorrin-8w decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MT0146
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26249
      • modified residue (0)
      • modified residue (18)
      • modified residue (25)
      • modified residue (72)
      • modified residue (86)
      • modified residue (143)
      • modified residue (171-172)
    Domains in SCOPe 2.07: d1f38c_
  • Chain 'D':
    Compound: precorrin-8w decarboxylase
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: MT0146
    Database cross-references and differences (RAF-indexed):
    • Uniprot O26249 (0-End)
      • modified residue (0)
      • modified residue (18)
      • modified residue (25)
      • modified residue (72)
      • modified residue (86)
      • modified residue (143)
      • modified residue (171-172)
    Domains in SCOPe 2.07: d1f38d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f38A (A:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgvshenkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f38A (A:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f38B (B:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgvshenkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f38B (B:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f38C (C:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgvshenkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f38C (C:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f38D (D:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgvshenkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f38D (D:)
    mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvya
    idrnpeaisttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilrii
    kdklkpggriivtailletkfeameclrdlgfdvnitelniargraldrgtmmvsrnpva
    liytgv