PDB entry 1f34

View 1f34 on RCSB PDB site
Description: crystal structure of ascaris pepsin inhibitor-3 bound to porcine pepsin
Class: hydrolase/hydrolase inhibitor
Keywords: proteinase-inhibitor complex, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2000-05-31, released 2001-02-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.218
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsin a
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00791 (0-325)
      • modified residue (67)
    Domains in SCOPe 2.05: d1f34a_
  • Chain 'B':
    Compound: major pepsin inhibitor pi-3
    Species: Ascaris suum [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f34b_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f34A (A:)
    igdeplenyldteyfgtigigtpaqdftvifdtgssnlwvpsvycsslacsdhnqfnpdd
    sstfeatsqelsitygtgsmtgilgydtvqvggisdtnqifglsetepgsflyyapfdgi
    lglaypsisasgatpvfdnlwdqglvsqdlfsvylssnddsgsvvllggidssyytgsln
    wvpvsvegywqitldsitmdgetiacsggcqaivdtgtslltgptsaianiqsdigasen
    sdgemviscssidslpdivftingvqyplspsayilqdddsctsgfegmdvptssgelwi
    lgdvfirqyytvfdrannkvglapva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f34B (B:)
    qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
    kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
    qppssgmphgavpagglspppppsfctvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f34B (B:)
    qflfsmstgpfictvkdnqvfvanlpwtmlegddiqvgkefaarvedctnvkhdmaptct
    kpppfcgpqdmkmfnfvgcsvlgnklfidqkyvrdltakdhaevqtfrekiaafeeqqen
    qppagglspppppsfctv