PDB entry 1f2x

View 1f2x on RCSB PDB site
Description:
Deposited on 2000-05-30, released 2000-06-08
The last revision prior to the SCOP 1.65 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'K':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1f2xk_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1f2xl_

PDB Chain Sequences:

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1f2xK (K:)
    qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
    svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
    qvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f2xK (K:)
    qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
    svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
    qvtvss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1f2xL (L:)
    qvqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygd
    svkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgt
    qvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f2xL (L:)
    vqlvesgggsvqaggslrlscaasgytvstycmgwfrqapgkeregvatilggstyygds
    vkgrftisqdnakntvylqmnslkpedtaiyycagstvastgwcsrlrpydyhyrgqgtq
    vtvssr