PDB entry 1f2v

View 1f2v on RCSB PDB site
Description: crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis
Class: isomerase
Keywords: alpha-beta wind, doubly wound sheet, ISOMERASE
Deposited on 2000-05-29, released 2001-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: precorrin-8x methylmutase
    Species: Pseudomonas denitrificans [TaxId:43306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f2va_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f2vA (A:)
    mrgshhhhhhpeydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveat
    rqfvfspdfvssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaae
    igntrsaaalklwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaae
    skdalaensygvpfaivrgrlggsamtaaalnslarpgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f2vA (A:)
    peydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveatrqfvfspdfv
    ssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaaeigntrsaaal
    klwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaaeskdalaensy
    gvpfaivrgrlggsamtaaalnslarpgl