PDB entry 1f2r

View 1f2r on RCSB PDB site
Description: nmr structure of the heterodimeric complex between cad domains of cad and icad
Deposited on 2000-05-29, released 2000-06-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-08-30, with a file datestamp of 2000-08-30.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Domains in SCOP 1.55: d1f2rc_
  • Chain 'I':
    Domains in SCOP 1.55: d1f2ri_

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2rC (C:)
    mcavlrqpkcvklralhsackfgvaarscqellrkgcvrfqlpmpgsrlclyedgtevtd
    dcfpglpndaelllltagetwhgyvsd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2rI (I:)
    melsrgasapdpddvrplkpcllrrnhsrdqhgvaassleelrskacellaidksltpit
    lvlaedgtivddddyflclpsntkfvalacnekwtyndsd