PDB entry 1f2m

View 1f2m on RCSB PDB site
Description: simplification of a protein loop in staphylococcal nuclease
Class: hydrolase
Keywords: protein engineering, cis peptide, cis - trans isomerization, hydrolase
Deposited on 2000-05-26, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: staphylococcal nuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered (113)
      • engineered (115)
    Domains in SCOPe 2.07: d1f2ma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f2mA (A:)
    atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayayapnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f2mA (A:)
    klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
    venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayayapnntheqhl
    rkseaqakkeklniws