PDB entry 1f2k

View 1f2k on RCSB PDB site
Description: crystal structure of acanthamoeba castellanii profilin II, cubic crystal form
Class: structural protein
Keywords: seven-stranded incomplete antiparallel up-and-down beta barrel, actin-binding protein, poly-l-proline binding protein, pip2 binding protein, structural protein
Deposited on 2000-05-26, released 2000-06-08
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: profilin II
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1f2ka_
  • Chain 'B':
    Compound: profilin II
    Species: Acanthamoeba castellanii [TaxId:5755]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1f2kb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2kA (A:)
    swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
    elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
    igqgf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2kB (B:)
    swqtyvdtnlvgtgavtqaaiighdgntwatsagfavspangaalanafkdatairsngf
    elagtryvtiraddrsvygkkgsagvitvktskailigvynekiqpgtaanvvekladyl
    igqgf