PDB entry 1f2h

View 1f2h on RCSB PDB site
Description: solution structure of the n-terminal domain of the tnfr1 associated protein, tradd.
Class: apoptosis
Keywords: TNFR-1 associated protein, APOPTOSIS
Deposited on 2000-05-24, released 2001-05-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tumor necrosis factor receptor type 1 associated death domain protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1f2ha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2hA (A:)
    maagqngheewvgsaylfvessldkvvlsdayahpqqkvavyralqaalaesggspdvlq
    mlkihrsdpqlivqlrfcgrqpcgrflrayregalraalqrslaaalaqhsvplqlelra
    gaerldalladeerclscilaqqpdrlrdeelaeledalrnlkcgsgar