PDB entry 1f2g

View 1f2g on RCSB PDB site
Description: the nmr solution structure of the 3fe ferredoxin II from desulfovibrio gigas, 15 structures
Class: electron transport
Keywords: electron transport, fdii desulfovibrio gigas, ferredoxin II
Deposited on 1998-10-08, released 1999-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin II
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1f2ga_
  • Heterogens: F3S

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2gA (A:)
    pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs