PDB entry 1f2f

View 1f2f on RCSB PDB site
Description: src sh2 thref1trp mutant
Class: transferase
Keywords: Src, SH2 domain, specificity switch, TRANSFERASE
Deposited on 2000-05-24, released 2000-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Proto-oncogene tyrosine-protein kinase Src
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00523 (1-103)
    • initiating met (0)
    • engineered (71)
  Domains in SCOPe 2.07: d1f2fa_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f2fA (A:)
  maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
  irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt