PDB entry 1f2f

View 1f2f on RCSB PDB site
Description: src sh2 thref1trp mutant
Deposited on 2000-05-24, released 2000-07-06
The last revision prior to the SCOP 1.55 freeze date was dated 2000-07-06, with a file datestamp of 2000-07-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.208
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1f2fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1f2fA (A:)
maeewyfgkitrreserlllnpenprgtflvresettkgayclsvsdfdnakglnvkhyk
irkldsggfyiwsrtqfsslqqlvayyskhadglchrltnvcpt