PDB entry 1f2b

View 1f2b on RCSB PDB site
Description: crystal structure analysis of cruzain bound to vinyl sulfone derived inhibitor (III)
Class: hydrolase
Keywords: cysteine protease, covalent inhibitor, vinyl sulfone-derived, P1' pocket, HYDROLASE
Deposited on 2000-05-23, released 2000-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cruzain
  Species: Trypanosoma cruzi [TaxId:5693]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25779 (0-214)
  Domains in SCOPe 2.08: d1f2ba_
• Heterogens: VS3, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1f2bA (A:)
  apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
  sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
  deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
  knswttqwgeegyiriakgsnqclvkeeassavvg