PDB entry 1f2a

View 1f2a on RCSB PDB site
Description: crystal structure analysis of cruzain bound to a vinyl sulfone derived inhibitor (II)
Class: hydrolase
Keywords: cysteine protease, covalent inhibitor, vinyl sulfone derived, P1' pocket, HYDROLASE
Deposited on 2000-05-23, released 2000-07-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cruzain
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f2aa_
  • Heterogens: VS2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f2aA (A:)
    apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlseqmlvscdktd
    sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
    deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndsaavpywii
    knswttqwgeegyiriakgsnqclvkeeassavvg