PDB entry 1f28

View 1f28 on RCSB PDB site
Description: crystal structure of thymidylate synthase from pneumocystis carinii bound to dump and bw1843u89
Class: transferase
Keywords: beta-sheet, protein-inhibitor complex, TRANSFERASE
Deposited on 2000-05-23, released 2001-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thymidylate synthase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f28a_
  • Chain 'B':
    Compound: Thymidylate synthase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f28b_
  • Chain 'C':
    Compound: Thymidylate synthase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f28c_
  • Chain 'D':
    Compound: Thymidylate synthase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1f28d_
  • Heterogens: UMP, F89, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f28A (A:)
    mvnaeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfir
    gvieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhf
    gaeyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfy
    vhipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdch
    iykdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f28A (A:)
    naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
    ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
    eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
    ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
    kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1f28B (B:)
    mvnaeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfir
    gvieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhf
    gaeyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfy
    vhipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdch
    iykdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f28B (B:)
    naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
    ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
    eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
    ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
    kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1f28C (C:)
    mvnaeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfir
    gvieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhf
    gaeyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfy
    vhipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdch
    iykdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f28C (C:)
    naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
    ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
    eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
    ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
    kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1f28D (D:)
    mvnaeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfir
    gvieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhf
    gaeyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfy
    vhipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdch
    iykdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f28D (D:)
    naeeqqylnlvqyiinhgedrpdrtgtgtlsvfapsplkfslrnktfpllttkrvfirgv
    ieellwfirgetdslklreknihiwdangsreyldsigltkrqegdlgpiygfqwrhfga
    eyidcktnyigqgvdqlaniiqkirtspydrrlilsawnpadlekmalppchmfcqfyvh
    ipsnnhrpelscqlyqrscdmglgvpfniasyalltcmiahvcdldpgdfihvmgdchiy
    kdhiealqqqltrsprpfptlslnrsitdiedftlddfniqnyhpyetikmkmsi