PDB entry 1f25

View 1f25 on RCSB PDB site
Description: crystal structure of no complex of thr243asn mutants of cytochrome p450nor
Deposited on 2000-05-23, released 2000-11-23
The last revision prior to the SCOP 1.57 freeze date was dated 2000-11-23, with a file datestamp of 2000-11-23.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.142
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1f25a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1f25A (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnanm
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif