PDB entry 1f24

View 1f24 on RCSB PDB site
Description: crystal structure of no complex of thr243ala mutants of cytochrome p450nor
Class: oxidoreductase
Keywords: nitric oxide reductase, Cytochrome P450nor, OXIDOREDUCTASE
Deposited on 2000-05-23, released 2000-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.139
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide reductase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23295 (Start-401)
      • engineered (241)
    Domains in SCOPe 2.08: d1f24a_
  • Heterogens: HEM, NO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1f24A (A:)
    asgapsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatsekls
    kvrtrqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtv
    ddlleqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngssta
    reasaanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagn
    aamvnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmig
    dklvranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakae
    lttvfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif
    

    Sequence, based on observed residues (ATOM records): (download)
    >1f24A (A:)
    apsfpfsrasgpeppaefaklratnpvsqvklfdgslawlvtkhkdvcfvatseklskvr
    trqgfpelsasgkqaakakptfvdmdppehmhqrsmveptftpeavknlqpyiqrtvddl
    leqmkqkgcangpvdlvkefalpvpsyiiytllgvpfndleyltqqnairtngsstarea
    saanqelldylailveqrlvepkddiisklcteqvkpgnidksdavqiaflllvagnaam
    vnmialgvatlaqhpdqlaqlkanpslapqfveelcryhtasalaikrtakedvmigdkl
    vranegiiasnqsanrdeevfenpdefnmnrkwppqdplgfgfgdhrciaehlakaeltt
    vfstlyqkfpdlkvavplgkinytplnrdvgivdlpvif